PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E01986.1.p
Common NameEUGRSUZ_E01986
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 116aa    MW: 13394.3 Da    PI: 8.7807
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E01986.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR159.61e-181396390
              FAR1  3 YneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                      Y +YA   GF vrksk++k+ ++geit+r fvC++ g++ +++++  +++ +++e r+gC a +k k e +g+ ev + ++eHn e+ 
  Eucgr.E01986.1.p 13 YVSYAIGKGFGVRKSKTRKN-DKGEITRRIFVCNCAGYSVNSSDQ--EKKYEKPEVRCGCPALIKFKVE-NGVHEVVEYVSEHNYEFI 96
                      99**************9998.8888**************999877..9999*****************9.**************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.8E-161396IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MVFASELEAY YKYVSYAIGK GFGVRKSKTR KNDKGEITRR IFVCNCAGYS VNSSDQEKKY  60
EKPEVRCGCP ALIKFKVENG VHEVVEYVSE HNYEFIPEHQ RHLIRCERMI SNTCK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E01986.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010027018.12e-55PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_010056981.11e-54PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A059C5701e-80A0A059C570_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2758922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.28e-12FAR1 family protein